1. ENZYMATIC SYNTHESIS OF THE ANTI-LEUKEMIC Δ12-PROSTAGLANDIN J3 Open Access Author: Frisbie, James Wagner Title: ENZYMATIC SYNTHESIS OF THE ANTI-LEUKEMIC Δ12-PROSTAGLANDIN J3 Area of Honors: Immunology and Infectious Disease Keywords: prostaglandinleukemiasynthesisCOXH-PGDSenzymaticstemcells File: Download JamesFrisbie_SHC_Thesis_Final.pdf Thesis Supervisors: Dr. Kumble Sandeep Prabhu, Thesis SupervisorDr. Pamela A. Hankey-Giblin, Thesis Honors Advisor
2. Determining If Serum Shock and Dexamethasone Initiate Circadian Rhythms in Bovine MAC-T Mammary Epithelial Cells Open Access Author: Reineke, Rachel A Title: Determining If Serum Shock and Dexamethasone Initiate Circadian Rhythms in Bovine MAC-T Mammary Epithelial Cells Area of Honors: Veterinary and Biomedical Sciences Keywords: circadian rhythmsdexamethasoneserum shockbiological rhythmsdairynutritioncell culturein vitroMAC-Tentrained rhythmperipheral clockbovinemammaryepithelialcellscircadianrhythmmilkproductiongene expressionRPS9CLOCKBMAL1PER1PER2CRY1 File: Download SHC_Thesis_Final_FINAL_ACTUAL___.pdf Thesis Supervisors: Dr. Kevin John Harvatine, Thesis SupervisorDr. Lester C Griel Jr., Thesis Honors Advisor
3. Effects of Extracellular Matrix Rigidity on the Sensitivity of the Aryl Hydrocarbon Receptor in Breast Cancer Cells Open Access Author: Pezzulo, Joshua Daniel Title: Effects of Extracellular Matrix Rigidity on the Sensitivity of the Aryl Hydrocarbon Receptor in Breast Cancer Cells Area of Honors: Chemical Engineering Keywords: mcf7extracellular matrixbreast cancercyp1a1ahrimmunofluorescencewestern blotdimcellsemtepithelialmesenchymaltransitionmtscruciferousvegetablesindolepolyacrylamide File: Download Pezzulo_Thesis_Final_2_.pdf Thesis Supervisors: Wayne Roger Curtis, Thesis Honors AdvisorEsther Gomez, Thesis Supervisor
