1. Determining If Serum Shock and Dexamethasone Initiate Circadian Rhythms in Bovine MAC-T Mammary Epithelial Cells Open Access Author: Reineke, Rachel A Title: Determining If Serum Shock and Dexamethasone Initiate Circadian Rhythms in Bovine MAC-T Mammary Epithelial Cells Area of Honors: Veterinary and Biomedical Sciences Keywords: circadian rhythmsdexamethasoneserum shockbiological rhythmsdairynutritioncell culturein vitroMAC-Tentrained rhythmperipheral clockbovinemammaryepithelialcellscircadianrhythmmilkproductiongene expressionRPS9CLOCKBMAL1PER1PER2CRY1 File: Download SHC_Thesis_Final_FINAL_ACTUAL___.pdf Thesis Supervisors: Dr. Kevin John Harvatine, Thesis SupervisorDr. Lester C Griel Jr., Thesis Honors Advisor
2. The Effects of Extracellular Matrix Rigidity on TGFβ-Induced Histone Modifications and α-SMA Expression in Mammary Epithelial Cells Open Access Author: Annamraju, Apoorva K Title: The Effects of Extracellular Matrix Rigidity on TGFβ-Induced Histone Modifications and α-SMA Expression in Mammary Epithelial Cells Area of Honors: Chemical Engineering Keywords: epithelialmesenchymalhydrogelhistoneα-SMATGFβYoung's modulusrheologycavitation rheology File: Download FINAL_THESIS_PDF.pdf Thesis Supervisors: Esther Winter Gomez, Thesis SupervisorDarrell Velegol, Thesis Honors Advisor
3. Effects of Extracellular Matrix Rigidity on the Sensitivity of the Aryl Hydrocarbon Receptor in Breast Cancer Cells Open Access Author: Pezzulo, Joshua Daniel Title: Effects of Extracellular Matrix Rigidity on the Sensitivity of the Aryl Hydrocarbon Receptor in Breast Cancer Cells Area of Honors: Chemical Engineering Keywords: mcf7extracellular matrixbreast cancercyp1a1ahrimmunofluorescencewestern blotdimcellsemtepithelialmesenchymaltransitionmtscruciferousvegetablesindolepolyacrylamide File: Download Pezzulo_Thesis_Final_2_.pdf Thesis Supervisors: Wayne Roger Curtis, Thesis Honors AdvisorEsther Gomez, Thesis Supervisor