31. The effect of external signals and combinatorial interventions in the epithelial-to-mesenchymal transition network model Open Access Author: Sarathy, Danyas Sharmila Title: The effect of external signals and combinatorial interventions in the epithelial-to-mesenchymal transition network model Area of Honors: Physics Keywords: EMTGraph TheoryDiscrete Dynamic Modeling File: Download Sarathy_Danyas_SchreyerThesis_Final.pdf Thesis Supervisors: Reka Z Albert, Thesis SupervisorProf. Richard Wallace Robinett, Thesis Honors Advisor
32. Countercurrent Staged Diafiltration for Monoclonal Antibody Formulation Open Access Author: Nambiar, Anirudh Manoj Kumar Title: Countercurrent Staged Diafiltration for Monoclonal Antibody Formulation Area of Honors: Chemical Engineering Keywords: UltrafiltrationDiafiltrationProteinContinuous Processing File: Download Honors_Thesis-Anirudh_Nambiar.pdf Thesis Supervisors: Andrew Zydney, Thesis SupervisorAndrew Zydney, Thesis Honors AdvisorDr. Manish Kumar, Faculty Reader
33. CLUTTER MODELS OF LAND DISTRIBUTED AND DISCRETE CLUTTER Open Access Author: Mehta, Harvish Hitesh Title: CLUTTER MODELS OF LAND DISTRIBUTED AND DISCRETE CLUTTER Area of Honors: Electrical Engineering Keywords: cluttercognitive radarmodelingdiscrete clutterradar File: Download mehtaharvishHT.pdf Thesis Supervisors: Dr. Ram Mohan Narayanan, Thesis SupervisorDr. Julio V. Urbina, Thesis Honors Advisor
34. DISTINGUISHING BETWEEN SPECIALISM AND OPPORTUNISM IN THE DIET OF HERRING GULLS Open Access Author: Post, Laura Renee Title: DISTINGUISHING BETWEEN SPECIALISM AND OPPORTUNISM IN THE DIET OF HERRING GULLS Area of Honors: Biology Keywords: herring gullopportunismspecialism File: Download Final_Thesis.pdf Thesis Supervisors: Dr. Jennifer Marie Arnold, Thesis SupervisorDr. Sandy Feinstein, Thesis Honors Advisor
35. Impact of Pulsatility and Flow Rates on Hemodynamic Energy Transmission in an Adult ECLS System Open Access Author: Wolfe, Rachel Morgan Title: Impact of Pulsatility and Flow Rates on Hemodynamic Energy Transmission in an Adult ECLS System Area of Honors: Biomedical Engineering Keywords: Extracorporeal life supportDiagonal pumpXLung oxygenatorAdultPulsatile flowExtracorporeal life supportDiagonal pumpXLung oxygenatorAdultPulsatile flow File: Download WolfeRachel_FinalThesisPDF.pdf Thesis Supervisors: Akif Undar, Thesis SupervisorDr. Nanyin Zhang, Thesis Honors Advisor
36. Determining If Serum Shock and Dexamethasone Initiate Circadian Rhythms in Bovine MAC-T Mammary Epithelial Cells Open Access Author: Reineke, Rachel A Title: Determining If Serum Shock and Dexamethasone Initiate Circadian Rhythms in Bovine MAC-T Mammary Epithelial Cells Area of Honors: Veterinary and Biomedical Sciences Keywords: circadian rhythmsdexamethasoneserum shockbiological rhythmsdairynutritioncell culturein vitroMAC-Tentrained rhythmperipheral clockbovinemammaryepithelialcellscircadianrhythmmilkproductiongene expressionRPS9CLOCKBMAL1PER1PER2CRY1 File: Download SHC_Thesis_Final_FINAL_ACTUAL___.pdf Thesis Supervisors: Dr. Kevin John Harvatine, Thesis SupervisorDr. Lester C Griel Jr., Thesis Honors Advisor
37. STUDYING SUPERCONDUCTING FLUCTUATIONS AND COLLECTIVE MODES IN OPTIMALLY DOPED FeSe1-xTex AN UNCONVENTIONAL SUPERCONDUCTOR IN THE BCS-BEC CROSSOVER REGIME Open Access Author: Vitalone, Rocco Alexander Title: STUDYING SUPERCONDUCTING FLUCTUATIONS AND COLLECTIVE MODES IN OPTIMALLY DOPED FeSe1-xTex AN UNCONVENTIONAL SUPERCONDUCTOR IN THE BCS-BEC CROSSOVER REGIME Area of Honors: Physics Keywords: High temperature superconductivityTerahertzSpectroscopyPump-Probe SpectroscopyUnique Superconductors File: Download Vitalone_Rocco_HTSCflucts.pdf Thesis Supervisors: Prof. Richard Wallace Robinett, Thesis Honors AdvisorProf. Jie Shan, Thesis Supervisor
38. Investigation of amorphous thin films using electrically detected magnetic resonance Open Access Author: Mclemore, Charles Armand Title: Investigation of amorphous thin films using electrically detected magnetic resonance Area of Honors: Engineering Science Keywords: thin filmmagnetic resonancezero-fieldmagnetoresistanceamorphousvariable range hoppingspin dependenttrap assisted tunnelingelectrically detected magnetic resonance File: Download McLemore_Charles_AmorphousFilmEDMR.pdf Thesis Supervisors: Dr. Patrick M Lenahan, Thesis SupervisorDr. Patrick M Lenahan, Thesis Honors AdvisorDr. Akhlesh Lakhtakia, Faculty Reader
39. DEVELOPMENT OF AN ARTIFICIAL NEURAL NETWORK FOR PREDICTION OF FLOWING BOTTOMHOLE PRESSURE IN VERTICAL OIL WELLS Open Access Author: Rodge, Mohnish Title: DEVELOPMENT OF AN ARTIFICIAL NEURAL NETWORK FOR PREDICTION OF FLOWING BOTTOMHOLE PRESSURE IN VERTICAL OIL WELLS Area of Honors: Petroleum and Natural Gas Engineering Keywords: Pressure gradient curvesArtificial Neural NetworkWell Test AnalysisPetroleum and Natural Gas EngineeringMultirate Well TestWellhead PressureBottomhole PressureWellbore PressureOilNatural Gasartificial liftmultiphase flow File: Download Final_Thesis_MohnishRodge.pdf Thesis Supervisors: Turgay Ertekin, Thesis SupervisorTurgay Ertekin, Thesis Honors AdvisorHamid Emami-Meybodi, Faculty Reader
40. Topology and Data Analysis Open Access Author: Zhou, Hangyu Title: Topology and Data Analysis Area of Honors: Mathematics Keywords: hoomologytopological data analysispersistent homologyalgebraic topology File: Download Zhou_Hangyu_Topology_and_Data_Analysis.pdf Thesis Supervisors: John Roe, Thesis SupervisorSergei Tabachnikov, Thesis Honors Advisor